PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g44770.1.p
Common NameBRADI_2g44770, LOC100832441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 218aa    MW: 24497.3 Da    PI: 6.517
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g44770.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.7e-171663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd++lv ++ q+G g+W+  ar  g++R +k+c++rw++yl
  Bradi2g44770.1.p 16 KGPWTLEEDLILVGYISQHGEGSWDNLARSAGLNRNGKSCRLRWLNYL 63
                      79********************************************97 PP

2Myb_DNA-binding521.6e-1669112146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ ++eEd  + +++++lG++ W+ Ia++++ gRt++++k++w++
  Bradi2g44770.1.p  69 RGSISPEEDMVIRELHTRLGNK-WSEIAKHLP-GRTDNEVKNYWRT 112
                       7888******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.131163IPR017930Myb domain
SuperFamilySSF466891.12E-3014110IPR009057Homeodomain-like
SMARTSM007178.7E-131565IPR001005SANT/Myb domain
PfamPF002491.0E-141663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-201769IPR009057Homeodomain-like
CDDcd001671.02E-91863No hitNo description
PROSITE profilePS5129423.56364118IPR017930Myb domain
SMARTSM007173.7E-1468116IPR001005SANT/Myb domain
PfamPF002493.6E-1469112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2470117IPR009057Homeodomain-like
CDDcd001677.58E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MARMICGRTG EPAVRKGPWT LEEDLILVGY ISQHGEGSWD NLARSAGLNR NGKSCRLRWL  60
NYLRPGLRRG SISPEEDMVI RELHTRLGNK WSEIAKHLPG RTDNEVKNYW RTRIHKKPHQ  120
SKLQLQAQQH PGLDSVATSE SASASASTSQ ASSTVGDEYM QASFPYPELT WVADQSDVGA  180
ITTRFFSSSD DFGDNVWNVE DRFWETLPFA DPVYEAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281211723127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3755161e-136AK375516.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3096J04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566926.21e-163PREDICTED: myb-related protein 340
TrEMBLI1HPS51e-163I1HPS5_BRADI; Uncharacterized protein
STRINGBRADI2G44770.11e-162(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132402633
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.11e-57myb domain protein 21